Anti RAE1 pAb (ATL-HPA048795)

Atlas Antibodies

Catalog No.: ATL-HPA048795-25

Protein Description: ribonucleic acid export 1
Gene Name: RAE1
Alternative Gene Name: Mnrp41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027509: 99%, ENSRNOG00000021295: 96%
Entrez Gene ID: 8480
Uniprot ID: P78406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
• Gene Sequence: VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
• Gene ID - Mouse: ENSMUSG00000027509
• Gene ID - Rat: ENSRNOG00000021295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAE1 pAb (ATL-HPA048795) – 1 Found

Meyers, Jordan M; Ramanathan, Muthukumar; Shanderson, Ronald L; Beck, Aimee; Donohue, Laura; Ferguson, Ian; Guo, Margaret G; Rao, Deepti S; Miao, Weili; Reynolds, David; Yang, Xue; Zhao, Yang; Yang, Yen-Yu; Blish, Catherine; Wang, Yinsheng; Khavari, Paul A. The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation. Plos Pathogens. 2021;17(10):e1009412.