Anti RAD23A pAb (ATL-HPA065599)

Atlas Antibodies

Catalog No.: ATL-HPA065599-25

Protein Description: RAD23 homolog A (S. cerevisiae)
Gene Name: RAD23A
Alternative Gene Name: HHR23A, MGC111083
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003813: 95%, ENSRNOG00000003026: 93%
Entrez Gene ID: 5886
Uniprot ID: P54725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ
• Gene Sequence: YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ
• Gene ID - Mouse: ENSMUSG00000003813
• Gene ID - Rat: ENSRNOG00000003026
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.