Anti RACGAP1 pAb (ATL-HPA043912 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043912-100

Protein Description: Rac GTPase activating protein 1
Gene Name: RACGAP1
Alternative Gene Name: MgcRacGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023015: 90%, ENSRNOG00000049033: 89%
Entrez Gene ID: 29127
Uniprot ID: Q9H0H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGGPIEAVSTIET
• Gene Sequence: SALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGGPIEAVSTIET
• Gene ID - Mouse: ENSMUSG00000023015
• Gene ID - Rat: ENSRNOG00000049033
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RACGAP1 pAb (ATL-HPA043912 w/enhanced validation) – 1 Found

Chen, Huaping; Wu, Junrong; Lu, Liuyi; Hu, Zuojian; Li, Xi; Huang, Li; Zhang, Xiaolian; Chen, Mingxing; Qin, Xue; Xie, Li. Identification of Hub Genes Associated With Immune Infiltration and Predict Prognosis in Hepatocellular Carcinoma via Bioinformatics Approaches. Frontiers In Genetics. 11( 33505422):575762.