Anti RAB28 pAb (ATL-HPA044575 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044575-100

Protein Description: RAB28, member RAS oncogene family
Gene Name: RAB28
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029128: 99%, ENSRNOG00000017074: 100%
Entrez Gene ID: 9364
Uniprot ID: P51157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAVQ
• Gene Sequence: HLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAVQ
• Gene ID - Mouse: ENSMUSG00000029128
• Gene ID - Rat: ENSRNOG00000017074
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.