Anti RAB11FIP5 pAb (ATL-HPA036407 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036407-25

Protein Description: RAB11 family interacting protein 5 (class I)
Gene Name: RAB11FIP5
Alternative Gene Name: GAF1, KIAA0857, pp75, RIP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051343: 85%, ENSRNOG00000056009: 87%
Entrez Gene ID: 26056
Uniprot ID: Q9BXF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQEL
• Gene Sequence: SPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQEL
• Gene ID - Mouse: ENSMUSG00000051343
• Gene ID - Rat: ENSRNOG00000056009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAB11FIP5 pAb (ATL-HPA036407 w/enhanced validation) – 1 Found

Bradley, Todd; Peppa, Dimitra; Pedroza-Pacheco, Isabela; Li, Dapeng; Cain, Derek W; Henao, Ricardo; Venkat, Vaishnavi; Hora, Bhavna; Chen, Yue; Vandergrift, Nathan A; Overman, R Glenn; Edwards, R Whitney; Woods, Chris W; Tomaras, Georgia D; Ferrari, Guido; Ginsburg, Geoffrey S; Connors, Mark; Cohen, Myron S; Moody, M Anthony; Borrow, Persephone; Haynes, Barton F. RAB11FIP5 Expression and Altered Natural Killer Cell Function Are Associated with Induction of HIV Broadly Neutralizing Antibody Responses. Cell. 2018;175(2):387-399.e17.