Anti QRFP pAb (ATL-HPA043377 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043377-25

Protein Description: pyroglutamylated RFamide peptide
Gene Name: QRFP
Alternative Gene Name: 26RFa, P518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043102: 73%, ENSRNOG00000046473: 75%
Entrez Gene ID: 347148
Uniprot ID: P83859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFR
• Gene Sequence: GREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFR
• Gene ID - Mouse: ENSMUSG00000043102
• Gene ID - Rat: ENSRNOG00000046473
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.