Anti PYGO1 pAb (ATL-HPA042248)

Atlas Antibodies

Catalog No.: ATL-HPA042248-25

Protein Description: pygopus family PHD finger 1
Gene Name: PYGO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034910: 90%, ENSRNOG00000051813: 88%
Entrez Gene ID: 26108
Uniprot ID: Q9Y3Y4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATK
• Gene Sequence: RMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATK
• Gene ID - Mouse: ENSMUSG00000034910
• Gene ID - Rat: ENSRNOG00000051813
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.