Anti PWWP2A pAb (ATL-HPA046733)

Atlas Antibodies

Catalog No.: ATL-HPA046733-25

Protein Description: PWWP domain containing 2A
Gene Name: PWWP2A
Alternative Gene Name: KIAA1935
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044950: 82%, ENSRNOG00000003936: 80%
Entrez Gene ID: 114825
Uniprot ID: Q96N64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSNTFQEGTEVKCEANGAVPDDPSPVPHPELSLAESLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPP
• Gene Sequence: QSNTFQEGTEVKCEANGAVPDDPSPVPHPELSLAESLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPP
• Gene ID - Mouse: ENSMUSG00000044950
• Gene ID - Rat: ENSRNOG00000003936
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.