Anti PTTG1IP pAb (ATL-HPA061827)

Atlas Antibodies

Catalog No.: ATL-HPA061827-25

Protein Description: pituitary tumor-transforming 1 interacting protein
Gene Name: PTTG1IP
Alternative Gene Name: C21orf1, C21orf3, PBF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009291: 87%, ENSRNOG00000001223: 90%
Entrez Gene ID: 754
Uniprot ID: P53801
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA
• Gene Sequence: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA
• Gene ID - Mouse: ENSMUSG00000009291
• Gene ID - Rat: ENSRNOG00000001223
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.