Anti PTRF pAb (ATL-HPA074213)

Atlas Antibodies

Catalog No.: ATL-HPA074213-25

Protein Description: polymerase I and transcript release factor
Gene Name: PTRF
Alternative Gene Name: cavin-1, CAVIN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004044: 94%, ENSRNOG00000019778: 97%
Entrez Gene ID: 284119
Uniprot ID: Q6NZI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
• Gene Sequence: VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
• Gene ID - Mouse: ENSMUSG00000004044
• Gene ID - Rat: ENSRNOG00000019778
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.