Anti PTPRK pAb (ATL-HPA054822)

Atlas Antibodies

Catalog No.: ATL-HPA054822-25

Protein Description: protein tyrosine phosphatase, receptor type, K
Gene Name: PTPRK
Alternative Gene Name: R-PTP-kappa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019889: 98%, ENSRNOG00000047605: 98%
Entrez Gene ID: 5796
Uniprot ID: Q15262
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE
• Gene Sequence: MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE
• Gene ID - Mouse: ENSMUSG00000019889
• Gene ID - Rat: ENSRNOG00000047605
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PTPRK pAb (ATL-HPA054822) – 1 Found

Matsushita, Masashi; Mori, Yusuke; Uchiumi, Kyosuke; Ogata, Takehiro; Nakamura, Mizuyo; Yoda, Hiroyuki; Soda, Hiroaki; Takiguchi, Nobuhiro; Nabeya, Yoshihiro; Shimozato, Osamu; Ozaki, Toshinori. PTPRK suppresses progression and chemo-resistance of colon cancer cells via direct inhibition of pro-oncogenic CD133. Febs Open Bio. 2019;9(5):935-946.