Anti PTPN18 pAb (ATL-HPA053367)

Atlas Antibodies

Catalog No.: ATL-HPA053367-25

Protein Description: protein tyrosine phosphatase, non-receptor type 18
Gene Name: PTPN18
Alternative Gene Name: BDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026126: 68%, ENSRNOG00000013415: 65%
Entrez Gene ID: 26469
Uniprot ID: Q99952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK
• Gene Sequence: EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK
• Gene ID - Mouse: ENSMUSG00000026126
• Gene ID - Rat: ENSRNOG00000013415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.