Anti PTK6 pAb (ATL-HPA036071)

Atlas Antibodies

Catalog No.:
ATL-HPA036071-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein tyrosine kinase 6
Gene Name: PTK6
Alternative Gene Name: BRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038751: 76%, ENSRNOG00000012987: 70%
Entrez Gene ID: 5753
Uniprot ID: Q13882
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWE
Gene Sequence IRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWE
Gene ID - Mouse ENSMUSG00000038751
Gene ID - Rat ENSRNOG00000012987
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PTK6 pAb (ATL-HPA036071)
Datasheet Anti PTK6 pAb (ATL-HPA036071) Datasheet (External Link)
Vendor Page Anti PTK6 pAb (ATL-HPA036071) at Atlas Antibodies

Documents & Links for Anti PTK6 pAb (ATL-HPA036071)
Datasheet Anti PTK6 pAb (ATL-HPA036071) Datasheet (External Link)
Vendor Page Anti PTK6 pAb (ATL-HPA036071)