Anti PTK6 pAb (ATL-HPA036071)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036071-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PTK6
Alternative Gene Name: BRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038751: 76%, ENSRNOG00000012987: 70%
Entrez Gene ID: 5753
Uniprot ID: Q13882
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWE |
| Gene Sequence | IRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWE |
| Gene ID - Mouse | ENSMUSG00000038751 |
| Gene ID - Rat | ENSRNOG00000012987 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PTK6 pAb (ATL-HPA036071) | |
| Datasheet | Anti PTK6 pAb (ATL-HPA036071) Datasheet (External Link) |
| Vendor Page | Anti PTK6 pAb (ATL-HPA036071) at Atlas Antibodies |
| Documents & Links for Anti PTK6 pAb (ATL-HPA036071) | |
| Datasheet | Anti PTK6 pAb (ATL-HPA036071) Datasheet (External Link) |
| Vendor Page | Anti PTK6 pAb (ATL-HPA036071) |