Anti PTK6 pAb (ATL-HPA036070)

Atlas Antibodies

Catalog No.: ATL-HPA036070-25

Protein Description: protein tyrosine kinase 6
Gene Name: PTK6
Alternative Gene Name: BRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038751: 77%, ENSRNOG00000012987: 78%
Entrez Gene ID: 5753
Uniprot ID: Q13882
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
• Gene Sequence: PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
• Gene ID - Mouse: ENSMUSG00000038751
• Gene ID - Rat: ENSRNOG00000012987
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.