Anti PTCHD3 pAb (ATL-HPA044613)

Atlas Antibodies

Catalog No.: ATL-HPA044613-25

Protein Description: patched domain containing 3
Gene Name: PTCHD3
Alternative Gene Name: FLJ44037, PTR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039198: 61%, ENSRNOG00000046946: 59%
Entrez Gene ID: 374308
Uniprot ID: Q3KNS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLVVSYSDSLLDPATFAEVSKLDGAVQDLRVAREKGSQIQYQQVCARYRALCVPPNPILYAWQVNKTLNLSSIS
• Gene Sequence: LLVVSYSDSLLDPATFAEVSKLDGAVQDLRVAREKGSQIQYQQVCARYRALCVPPNPILYAWQVNKTLNLSSIS
• Gene ID - Mouse: ENSMUSG00000039198
• Gene ID - Rat: ENSRNOG00000046946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.