Anti PSPC1 pAb (ATL-HPA038904 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038904-25

Protein Description: paraspeckle component 1
Gene Name: PSPC1
Alternative Gene Name: FLJ10955, PSP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021938: 98%, ENSRNOG00000020782: 96%
Entrez Gene ID: 55269
Uniprot ID: Q8WXF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
• Gene Sequence: PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
• Gene ID - Mouse: ENSMUSG00000021938
• Gene ID - Rat: ENSRNOG00000020782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSPC1 pAb (ATL-HPA038904 w/enhanced validation) – 1 Found

Torres, Manon; Becquet, Denis; Blanchard, Marie-Pierre; Guillen, Séverine; Boyer, Bénédicte; Moreno, Mathias; Franc, Jean-Louis; François-Bellan, Anne-Marie. Circadian RNA expression elicited by 3'-UTR IRAlu-paraspeckle associated elements. Elife. 2016;5( 27441387)