Anti PSMD6 pAb (ATL-HPA036922)

Atlas Antibodies

Catalog No.: ATL-HPA036922-25

Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
Gene Name: PSMD6
Alternative Gene Name: KIAA0107, p44S10, Rpn7, S10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021737: 95%, ENSRNOG00000006751: 94%
Entrez Gene ID: 9861
Uniprot ID: Q15008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALG
• Gene Sequence: NMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALG
• Gene ID - Mouse: ENSMUSG00000021737
• Gene ID - Rat: ENSRNOG00000006751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PSMD6 pAb (ATL-HPA036922) – 1 Found

Eisenberg-Lerner, Avital; Benyair, Ron; Hizkiahou, Noa; Nudel, Neta; Maor, Roey; Kramer, Matthias P; Shmueli, Merav D; Zigdon, Inbal; Cherniavsky Lev, Marina; Ulman, Adi; Sagiv, Jitka Yehudith; Dayan, Molly; Dassa, Bareket; Rosenwald, Mercedes; Shachar, Idit; Li, Jie; Wang, Yanzhuang; Dezorella, Nili; Khan, Suman; Porat, Ziv; Shimoni, Eyal; Avinoam, Ori; Merbl, Yifat. Golgi organization is regulated by proteasomal degradation. Nature Communications. 2020;11(1):409.