Anti PSMD4 pAb (ATL-HPA039252 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039252-25

Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Gene Name: PSMD4
Alternative Gene Name: AF, AF-1, Rpn10, S5A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005625: 100%, ENSRNOG00000021042: 100%
Entrez Gene ID: 5710
Uniprot ID: P55036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGI
• Gene Sequence: VCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGI
• Gene ID - Mouse: ENSMUSG00000005625
• Gene ID - Rat: ENSRNOG00000021042
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.