Anti PSMD13 pAb (ATL-HPA038692 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038692-100

Protein Description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
Gene Name: PSMD13
Alternative Gene Name: p40.5, Rpn9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025487: 99%, ENSRNOG00000014109: 99%
Entrez Gene ID: 5719
Uniprot ID: Q9UNM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQE
• Gene Sequence: LEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQE
• Gene ID - Mouse: ENSMUSG00000025487
• Gene ID - Rat: ENSRNOG00000014109
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.