Anti PSMC6 pAb (ATL-HPA042823)

Atlas Antibodies

Catalog No.: ATL-HPA042823-25

Protein Description: proteasome (prosome, macropain) 26S subunit, ATPase, 6
Gene Name: PSMC6
Alternative Gene Name: p42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021832: 100%, ENSRNOG00000007203: 100%
Entrez Gene ID: 5706
Uniprot ID: P62333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIR
• Gene Sequence: VGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIR
• Gene ID - Mouse: ENSMUSG00000021832
• Gene ID - Rat: ENSRNOG00000007203
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.