Anti PSMB5 pAb (ATL-HPA061796)

Atlas Antibodies

Catalog No.: ATL-HPA061796-25

Protein Description: proteasome subunit beta 5
Gene Name: PSMB5
Alternative Gene Name: MB1, X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022193: 86%, ENSRNOG00000013386: 88%
Entrez Gene ID: 5693
Uniprot ID: P28074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
• Gene Sequence: LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
• Gene ID - Mouse: ENSMUSG00000022193
• Gene ID - Rat: ENSRNOG00000013386
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.