Anti PSD4 pAb (ATL-HPA077847)

Atlas Antibodies

Catalog No.: ATL-HPA077847-25

Protein Description: pleckstrin and Sec7 domain containing 4
Gene Name: PSD4
Alternative Gene Name: EFA6B, TIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026979: 31%, ENSRNOG00000006079: 31%
Entrez Gene ID: 23550
Uniprot ID: Q8NDX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSSGILPKWTLDASQSSLLETDGEQPSSLKKKEAGEAPKPGEEVKSEGTARPAETGDVQPDIHLTSAEHENLRTPMNSSWLPG
• Gene Sequence: HSSGILPKWTLDASQSSLLETDGEQPSSLKKKEAGEAPKPGEEVKSEGTARPAETGDVQPDIHLTSAEHENLRTPMNSSWLPG
• Gene ID - Mouse: ENSMUSG00000026979
• Gene ID - Rat: ENSRNOG00000006079
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.