Anti PRSS35 pAb (ATL-HPA038788 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038788-25

Protein Description: protease, serine, 35
Gene Name: PRSS35
Alternative Gene Name: C6orf158, dJ223E3.1, MGC46520
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033491: 67%, ENSRNOG00000025184: 70%
Entrez Gene ID: 167681
Uniprot ID: Q8N3Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEWDFMWHLRKVPRIVSERTFHLTSPAFEADAKMMVNTVCGIECQKELPTPSLSELEDYLSYETVFENGTRTLTRVKVQDLVLEPTQNITTKGVSVRRK
• Gene Sequence: MEWDFMWHLRKVPRIVSERTFHLTSPAFEADAKMMVNTVCGIECQKELPTPSLSELEDYLSYETVFENGTRTLTRVKVQDLVLEPTQNITTKGVSVRRK
• Gene ID - Mouse: ENSMUSG00000033491
• Gene ID - Rat: ENSRNOG00000025184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.