Anti PRRT3 pAb (ATL-HPA035128)

Atlas Antibodies

Catalog No.:
ATL-HPA035128-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: proline-rich transmembrane protein 3
Gene Name: PRRT3
Alternative Gene Name: FLJ33674
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045009: 42%, ENSRNOG00000009863: 53%
Entrez Gene ID: 285368
Uniprot ID: Q5FWE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTFIPTTPRRQLRVATVPPSLQHEGQEGQWPPRDEGLKAKTKSRVPPTSPSDHQGPPHTLVSHSGTVKRPVLEGQGGFEEHLQEAAQGPHFTQQD
Gene Sequence LTFIPTTPRRQLRVATVPPSLQHEGQEGQWPPRDEGLKAKTKSRVPPTSPSDHQGPPHTLVSHSGTVKRPVLEGQGGFEEHLQEAAQGPHFTQQD
Gene ID - Mouse ENSMUSG00000045009
Gene ID - Rat ENSRNOG00000009863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRRT3 pAb (ATL-HPA035128)
Datasheet Anti PRRT3 pAb (ATL-HPA035128) Datasheet (External Link)
Vendor Page Anti PRRT3 pAb (ATL-HPA035128) at Atlas Antibodies

Documents & Links for Anti PRRT3 pAb (ATL-HPA035128)
Datasheet Anti PRRT3 pAb (ATL-HPA035128) Datasheet (External Link)
Vendor Page Anti PRRT3 pAb (ATL-HPA035128)