Anti PRPF40B pAb (ATL-HPA038426 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038426-25

Protein Description: PRP40 pre-mRNA processing factor 40 homolog B (S. cerevisiae)
Gene Name: PRPF40B
Alternative Gene Name: HYPC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023007: 83%, ENSRNOG00000052539: 83%
Entrez Gene ID: 25766
Uniprot ID: Q6NWY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSNSPESETDPEEKAGKESDEKEQEQDKDRELQQAELPNRSPGFGIKKEKTGWDTSESE
• Gene Sequence: KSNSPESETDPEEKAGKESDEKEQEQDKDRELQQAELPNRSPGFGIKKEKTGWDTSESE
• Gene ID - Mouse: ENSMUSG00000023007
• Gene ID - Rat: ENSRNOG00000052539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.