Anti PRPF3 pAb (ATL-HPA067116)

Atlas Antibodies

Catalog No.: ATL-HPA067116-25

Protein Description: pre-mRNA processing factor 3
Gene Name: PRPF3
Alternative Gene Name: hPrp3, Prp3, RP18, SNRNP90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015748: 100%, ENSRNOG00000025629: 100%
Entrez Gene ID: 9129
Uniprot ID: O43395
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQ
• Gene Sequence: PSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQ
• Gene ID - Mouse: ENSMUSG00000015748
• Gene ID - Rat: ENSRNOG00000025629
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.