Anti PRODH2 pAb (ATL-HPA051287)

Atlas Antibodies

Catalog No.: ATL-HPA051287-25

Protein Description: proline dehydrogenase (oxidase) 2
Gene Name: PRODH2
Alternative Gene Name: HSPOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036892: 72%, ENSRNOG00000057578: 65%
Entrez Gene ID: 58510
Uniprot ID: Q9UF12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQ
• Gene Sequence: GNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQ
• Gene ID - Mouse: ENSMUSG00000036892
• Gene ID - Rat: ENSRNOG00000057578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.