Anti PRKAA2 pAb (ATL-HPA044540)

Atlas Antibodies

Catalog No.: ATL-HPA044540-25

Protein Description: protein kinase, AMP-activated, alpha 2 catalytic subunit
Gene Name: PRKAA2
Alternative Gene Name: AMPK, AMPKa2, PRKAA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028518: 94%, ENSRNOG00000007706: 94%
Entrez Gene ID: 5563
Uniprot ID: P54646
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
• Gene Sequence: IDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
• Gene ID - Mouse: ENSMUSG00000028518
• Gene ID - Rat: ENSRNOG00000007706
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.