Anti PRIM1 pAb (ATL-HPA040010)

Atlas Antibodies

Catalog No.:
ATL-HPA040010-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: primase, DNA, polypeptide 1 (49kDa)
Gene Name: PRIM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025395: 98%, ENSRNOG00000031993: 74%
Entrez Gene ID: 5557
Uniprot ID: P49642
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
Gene Sequence ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
Gene ID - Mouse ENSMUSG00000025395
Gene ID - Rat ENSRNOG00000031993
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PRIM1 pAb (ATL-HPA040010)
Datasheet Anti PRIM1 pAb (ATL-HPA040010) Datasheet (External Link)
Vendor Page Anti PRIM1 pAb (ATL-HPA040010) at Atlas Antibodies

Documents & Links for Anti PRIM1 pAb (ATL-HPA040010)
Datasheet Anti PRIM1 pAb (ATL-HPA040010) Datasheet (External Link)
Vendor Page Anti PRIM1 pAb (ATL-HPA040010)