Anti PPTC7 pAb (ATL-HPA039335 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039335-25

Protein Description: PTC7 protein phosphatase homolog (S. cerevisiae)
Gene Name: PPTC7
Alternative Gene Name: TA-PP2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038582: 99%, ENSRNOG00000021440: 99%
Entrez Gene ID: 160760
Uniprot ID: Q8NI37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL
• Gene Sequence: ILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQL
• Gene ID - Mouse: ENSMUSG00000038582
• Gene ID - Rat: ENSRNOG00000021440
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPTC7 pAb (ATL-HPA039335 w/enhanced validation) – 2 Found

Mishra, Ajay; Oulès, Bénédicte; Pisco, Angela Oliveira; Ly, Tony; Liakath-Ali, Kifayathullah; Walko, Gernot; Viswanathan, Priyalakshmi; Tihy, Matthieu; Nijjher, Jagdeesh; Dunn, Sara-Jane; Lamond, Angus I; Watt, Fiona M. A protein phosphatase network controls the temporal and spatial dynamics of differentiation commitment in human epidermis. Elife. 2017;6( 29043977) 

Fuhrmann, Dominik C; Brüne, Bernhard. miR-193a-3p increases glycolysis under hypoxia by facilitating Akt phosphorylation and PFKFB3 activation in human macrophages. Cellular And Molecular Life Sciences : Cmls. 2022;79(2):89.