Anti PPP4R2 pAb (ATL-HPA034695)

Atlas Antibodies

Catalog No.: ATL-HPA034695-25

Protein Description: protein phosphatase 4, regulatory subunit 2
Gene Name: PPP4R2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052144: 72%, ENSRNOG00000024647: 67%
Entrez Gene ID: 151987
Uniprot ID: Q9NY27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASSSSQDKDKDSRCTRQH
• Gene Sequence: NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASSSSQDKDKDSRCTRQH
• Gene ID - Mouse: ENSMUSG00000052144
• Gene ID - Rat: ENSRNOG00000024647
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.