Anti PPP1R7 pAb (ATL-HPA034501 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034501-25

Protein Description: protein phosphatase 1, regulatory subunit 7
Gene Name: PPP1R7
Alternative Gene Name: sds22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026275: 95%, ENSRNOG00000012015: 36%
Entrez Gene ID: 5510
Uniprot ID: Q15435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENL
• Gene Sequence: EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENL
• Gene ID - Mouse: ENSMUSG00000026275
• Gene ID - Rat: ENSRNOG00000012015
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.