Anti PPP1R13L pAb (ATL-HPA041231 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041231-25

Protein Description: protein phosphatase 1, regulatory subunit 13 like
Gene Name: PPP1R13L
Alternative Gene Name: IASPP, RAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040734: 84%, ENSRNOG00000025350: 82%
Entrez Gene ID: 10848
Uniprot ID: Q8WUF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSP
• Gene Sequence: DSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSP
• Gene ID - Mouse: ENSMUSG00000040734
• Gene ID - Rat: ENSRNOG00000025350
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPP1R13L pAb (ATL-HPA041231 w/enhanced validation) – 1 Found

Mangon, Aurélie; Salaün, Danièle; Bouali, Mohamed Lala; Kuzmić, Mira; Quitard, Sabine; Thuault, Sylvie; Isnardon, Daniel; Audebert, Stéphane; Puech, Pierre-Henri; Verdier-Pinard, Pascal; Badache, Ali. iASPP contributes to cell cortex rigidity, mitotic cell rounding, and spindle positioning. The Journal Of Cell Biology. 2021;220(12)