Anti PPM1M pAb (ATL-HPA036905)

Atlas Antibodies

Catalog No.: ATL-HPA036905-25

Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1M
Gene Name: PPM1M
Alternative Gene Name: FLJ32332, PP2Ceta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020253: 89%, ENSRNOG00000046535: 94%
Entrez Gene ID: 132160
Uniprot ID: Q96MI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVLDVDQLELQEDDVVVMATDG
• Gene Sequence: TLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTVLDVDQLELQEDDVVVMATDG
• Gene ID - Mouse: ENSMUSG00000020253
• Gene ID - Rat: ENSRNOG00000046535
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.