Anti PPM1G pAb (ATL-HPA035530 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035530-25

Protein Description: protein phosphatase, Mg2+/Mn2+ dependent, 1G
Gene Name: PPM1G
Alternative Gene Name: PP2CG, PP2Cgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029147: 93%, ENSRNOG00000026905: 97%
Entrez Gene ID: 5496
Uniprot ID: O15355
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD
• Gene Sequence: NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD
• Gene ID - Mouse: ENSMUSG00000029147
• Gene ID - Rat: ENSRNOG00000026905
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.