Anti PPIP5K2 pAb (ATL-HPA038442)

Atlas Antibodies

Catalog No.: ATL-HPA038442-25

Protein Description: diphosphoinositol pentakisphosphate kinase 2
Gene Name: PPIP5K2
Alternative Gene Name: HISPPD1, KIAA0433, VIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040648: 99%, ENSRNOG00000011613: 31%
Entrez Gene ID: 23262
Uniprot ID: O43314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSVSSPEGTGTWLHYTSGVGTGRRRRRSGEQITSSPVSPKSLAFTSSIFGSWQQVVSENANYLRTPRTLVEQKQNPTVGSHCA
• Gene Sequence: LSVSSPEGTGTWLHYTSGVGTGRRRRRSGEQITSSPVSPKSLAFTSSIFGSWQQVVSENANYLRTPRTLVEQKQNPTVGSHCA
• Gene ID - Mouse: ENSMUSG00000040648
• Gene ID - Rat: ENSRNOG00000011613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.