Anti PPHLN1 pAb (ATL-HPA038903 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038903-25

Protein Description: periphilin 1
Gene Name: PPHLN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036167: 70%, ENSRNOG00000022778: 70%
Entrez Gene ID: 51535
Uniprot ID: Q8NEY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIESAGQTWQQVPPVRNTEMDHDG
• Gene Sequence: STAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIESAGQTWQQVPPVRNTEMDHDG
• Gene ID - Mouse: ENSMUSG00000036167
• Gene ID - Rat: ENSRNOG00000022778
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.