Anti-PPFIBP1 pAb (ATL-HPA071162)

Atlas Antibodies

Catalog No.:
ATL-HPA071162-100
Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil and cytoplasm of neuronal cells.
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to plasma membrane.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human PPFIBP1, Gene description: PPFIA binding protein 1, Alternative Gene Names: hSGT2, hSgt2p, L2, SGT2, Validated applications: ICC, IHC, WB, Uniprot ID: Q86W92, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLEQMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAARSPSASITDEDSN
Gene Sequence EEYVCPMELGQASGSASKKGFKPGLDMRLYEEDDLDRLEQMEDSEGTVRQIGAFSEGINNLTHMLKEDDMFKDFAARSPSASITDEDSN
Gene ID - Mouse ENSMUSG00000016487
Gene ID - Rat ENSRNOG00000031709
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-PPFIBP1 pAb (ATL-HPA071162)
Vendor Page Anti-PPFIBP1 pAb (ATL-HPA071162) at Atlas Antibodies

Documents & Links for Anti-PPFIBP1 pAb (ATL-HPA071162)
Vendor Page Anti-PPFIBP1 pAb (ATL-HPA071162)
!