Anti PPAT pAb (ATL-HPA036091)

Atlas Antibodies

Catalog No.: ATL-HPA036091-25

Protein Description: phosphoribosyl pyrophosphate amidotransferase
Gene Name: PPAT
Alternative Gene Name: GPAT, PRAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029246: 97%, ENSRNOG00000002128: 97%
Entrez Gene ID: 5471
Uniprot ID: Q06203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPI
• Gene Sequence: PAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPI
• Gene ID - Mouse: ENSMUSG00000029246
• Gene ID - Rat: ENSRNOG00000002128
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PPAT pAb (ATL-HPA036091) – 1 Found

Chu, Qingfei; Gu, Xinyu; Zheng, Qiuxian; Wang, Jing; Zhu, Haihong. Phosphoribosyl Pyrophosphate Amido Transferase: A New Prognostic Biomarker for Hepatocellular Carcinoma. International Journal Of General Medicine. 15( 35027843):353-358.