Anti POMGNT2 pAb (ATL-HPA034870)

Atlas Antibodies

Catalog No.: ATL-HPA034870-25

Protein Description: protein O-linked mannose N-acetylglucosaminyltransferase 2 (beta 1,4-)
Gene Name: POMGNT2
Alternative Gene Name: AGO61, C3orf39, FLJ14566, GTDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066235: 96%, ENSRNOG00000019492: 96%
Entrez Gene ID: 84892
Uniprot ID: Q8NAT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRAEQARILQSREVPRHLCCRN
• Gene Sequence: VTTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRAEQARILQSREVPRHLCCRN
• Gene ID - Mouse: ENSMUSG00000066235
• Gene ID - Rat: ENSRNOG00000019492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.