Anti POLR3D pAb (ATL-HPA067875)

Atlas Antibodies

Catalog No.: ATL-HPA067875-25

Protein Description: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Gene Name: POLR3D
Alternative Gene Name: BN51T, RPC4, TSBN51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000776: 92%, ENSRNOG00000010028: 95%
Entrez Gene ID: 661
Uniprot ID: P05423
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQE
• Gene Sequence: LPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQE
• Gene ID - Mouse: ENSMUSG00000000776
• Gene ID - Rat: ENSRNOG00000010028
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.