Anti POLR2J pAb (ATL-HPA042997)

Atlas Antibodies

Catalog No.: ATL-HPA042997-25

Protein Description: polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Gene Name: POLR2J
Alternative Gene Name: hRPB14, POLR2J1, RPB11, RPB11A, RPB11m
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025314: 37%, ENSRNOG00000056955: 33%
Entrez Gene ID: 5439
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD
• Gene Sequence: VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD
• Gene ID - Mouse: ENSMUSG00000025314
• Gene ID - Rat: ENSRNOG00000056955
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.