Anti POLG pAb (ATL-HPA078482)

Atlas Antibodies

Catalog No.: ATL-HPA078482-25

Protein Description: DNA polymerase gamma, catalytic subunit
Gene Name: POLG
Alternative Gene Name: POLG1, POLGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039176: 83%, ENSRNOG00000032293: 81%
Entrez Gene ID: 5428
Uniprot ID: P54098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTD
• Gene Sequence: PKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTD
• Gene ID - Mouse: ENSMUSG00000039176
• Gene ID - Rat: ENSRNOG00000032293
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.