Anti POLD4 pAb (ATL-HPA078008)

Atlas Antibodies

SKU: ATL-HPA078008-25

• 

Protein Description: DNA polymerase delta 4, accessory subunit
Gene Name: POLD4
Alternative Gene Name: p12, POLDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097508: 84%, ENSRNOG00000018765: 86%
Entrez Gene ID: 57804
Uniprot ID: Q9HCU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYP
• Gene Sequence: WQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYP
• Gene ID - Mouse: ENSMUSG00000097508
• Gene ID - Rat: ENSRNOG00000018765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.