Anti POFUT2 pAb (ATL-HPA044297)

Atlas Antibodies

Catalog No.: ATL-HPA044297-25

Protein Description: protein O-fucosyltransferase 2
Gene Name: POFUT2
Alternative Gene Name: C21orf80, FUT13, KIAA0958
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020260: 97%, ENSRNOG00000001228: 97%
Entrez Gene ID: 23275
Uniprot ID: Q9Y2G5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
• Gene Sequence: PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
• Gene ID - Mouse: ENSMUSG00000020260
• Gene ID - Rat: ENSRNOG00000001228
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.