Anti PNPLA2 pAb (ATL-HPA062602)

Atlas Antibodies

SKU: ATL-HPA062602-25

• 

Protein Description: patatin-like phospholipase domain containing 2
Gene Name: PNPLA2
Alternative Gene Name: ATGL, desnutrin, FP17548, iPLA2zeta, TTS-2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025509: 88%, ENSRNOG00000047551: 87%
Entrez Gene ID: 57104
Uniprot ID: Q96AD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA
• Gene Sequence: FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA
• Gene ID - Mouse: ENSMUSG00000025509
• Gene ID - Rat: ENSRNOG00000047551
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.