Anti PLIN5 pAb (ATL-HPA077050)

Atlas Antibodies

Catalog No.: ATL-HPA077050-25

Protein Description: perilipin 5
Gene Name: PLIN5
Alternative Gene Name: LSDA5, LSDP5, MLDP, OXPAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011305: 59%, ENSRNOG00000047860: 62%
Entrez Gene ID: 440503
Uniprot ID: Q00G26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD
• Gene Sequence: GPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELD
• Gene ID - Mouse: ENSMUSG00000011305
• Gene ID - Rat: ENSRNOG00000047860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.