Anti PLEKHH2 pAb (ATL-HPA077225)

Atlas Antibodies

SKU: ATL-HPA077225-25

• 

Protein Description: pleckstrin homology domain containing, family H (with MyTH4 domain) member 2
Gene Name: PLEKHH2
Alternative Gene Name: KIAA2028, PLEKHH1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040852: 74%, ENSRNOG00000005124: 77%
Entrez Gene ID: 130271
Uniprot ID: Q8IVE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQWKALNSPLGKGNSE
• Gene Sequence: STLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQWKALNSPLGKGNSE
• Gene ID - Mouse: ENSMUSG00000040852
• Gene ID - Rat: ENSRNOG00000005124
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.