Anti PLEKHG6 pAb (ATL-HPA041459)

Atlas Antibodies

Catalog No.: ATL-HPA041459-25

Protein Description: pleckstrin homology domain containing, family G (with RhoGef domain) member 6
Gene Name: PLEKHG6
Alternative Gene Name: FLJ10665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038167: 84%, ENSRNOG00000019528: 83%
Entrez Gene ID: 55200
Uniprot ID: Q3KR16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCE
• Gene Sequence: GLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCE
• Gene ID - Mouse: ENSMUSG00000038167
• Gene ID - Rat: ENSRNOG00000019528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.