Anti PLEKHA7 pAb (ATL-HPA038610 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038610-25

Protein Description: pleckstrin homology domain containing, family A member 7
Gene Name: PLEKHA7
Alternative Gene Name: DKFZp686M22243
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045659: 74%, ENSRNOG00000024602: 75%
Entrez Gene ID: 144100
Uniprot ID: Q6IQ23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSLKRDMEKVERQAVPQANHTESCHECGRVGPGHTRDCPHRGHDDIVNFERQEQEGEQYRSQRDPLEGKRDRSKARSPYSPAEEDALFMDLPTGP
• Gene Sequence: SSLKRDMEKVERQAVPQANHTESCHECGRVGPGHTRDCPHRGHDDIVNFERQEQEGEQYRSQRDPLEGKRDRSKARSPYSPAEEDALFMDLPTGP
• Gene ID - Mouse: ENSMUSG00000045659
• Gene ID - Rat: ENSRNOG00000024602
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLEKHA7 pAb (ATL-HPA038610 w/enhanced validation) – 7 Found

Kourtidis, Antonis; Anastasiadis, Panos Z. PLEKHA7 defines an apical junctional complex with cytoskeletal associations and miRNA-mediated growth implications. Cell Cycle (Georgetown, Tex.). 15(4):498-505. 

Kourtidis, Antonis; Necela, Brian; Lin, Wan-Hsin; Lu, Ruifeng; Feathers, Ryan W; Asmann, Yan W; Thompson, E Aubrey; Anastasiadis, Panos Z. Cadherin complexes recruit mRNAs and RISC to regulate epithelial cell signaling. The Journal Of Cell Biology. 2017;216(10):3073-3085. 

Kurita, Souichi; Yamada, Tomohiro; Rikitsu, Etsuko; Ikeda, Wataru; Takai, Yoshimi. Binding between the junctional proteins afadin and PLEKHA7 and implication in the formation of adherens junction in epithelial cells. The Journal Of Biological Chemistry. 2013;288(41):29356-68. 

Soroosh, Artin; Rankin, Carl R; Polytarchou, Christos; Lokhandwala, Zulfiqar A; Patel, Ami; Chang, Lin; Pothoulakis, Charalabos; Iliopoulos, Dimitrios; Padua, David M. miR-24 Is Elevated in Ulcerative Colitis Patients and Regulates Intestinal Epithelial Barrier Function. The American Journal Of Pathology. 2019;189(9):1763-1774. 

Nair-Menon, Joyce; Daulagala, Amanda C; Connor, Dean M; Rutledge, Lauren; Penix, Trevor; Bridges, Mary Catherine; Wellslager, Bridgette; Spyropoulos, Demetri D; Timmers, Cynthia D; Broome, Ann-Marie; Kourtidis, Antonis. Predominant Distribution of the RNAi Machinery at Apical Adherens Junctions in Colonic Epithelia Is Disrupted in Cancer. International Journal Of Molecular Sciences. 2020;21(7) 

Pence, Lindy J; Kourtidis, Antonis; Feathers, Ryan W; Haddad, Mary T; Sotiriou, Sotiris; Decker, Paul A; Nassar, Aziza; Ocal, Idris T; Shah, Sejal S; Anastasiadis, Panos Z. PLEKHA7, an Apical Adherens Junction Protein, Suppresses Inflammatory Breast Cancer in the Context of High E-Cadherin and p120-Catenin Expression. International Journal Of Molecular Sciences. 2021;22(3) 

Daulagala, Amanda C; Kourtidis, Antonis. ECM Substrates Impact RNAi Localization at Adherens Junctions of Colon Epithelial Cells. Cells. 2022;11(23)